Peptide Grading
Research peptide
Sermorelin
From
$19.99
Vendors
15
Lab tested
2 COAs
Key benefits
- Raises natural GH release
- Improved growth in GH-deficient children
- Used as a pituitary function test
- Body feedback limits GH overshoot
Sermorelin is the amidated 1–29 fragment of human growth hormone-releasing hormone (GHRH), with the peptide sequence YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂.
It has been studied extensively in human endocrine research, particularly for growth hormone (GH) release, pituitary responsiveness, dose-related responses, feedback mechanisms, and factors that influence GHRH-stimulated GH secretion.
Peptide Grading compares current Sermorelin listings by supplier, quantity, specifications, COA availability, shipping, and price per mg.
Typical dose
200-300 mcg Once daily
Once daily before bed
Route
Subcutaneous
Best administered before bed on an empty stomach to amplify natural nighttime GH pulse.
Cycle
3-6 months Typical duration
Storage
2-8°C Refrigerated
Follow vendor guidance
Marketplace
Compare all Sermorelin vendors
Prices per size, coupon codes, lab reports and shipping.
| Vendor | Price | Coupon | Lab test | Shipping | |
|---|---|---|---|---|---|
Biologix Labs 2 mg | $19.99$24.99 Lowest price−20%$9.99/mg | Not on file | 2 Days
| Buy | |
HLX LABS 5 mg | $29.99 $6.00/mg | Not on file | 2–5 days
| Buy | |
Amino Club 10 mg | $30.00$59.99 −50%$3.00/mg | Not on file | 1–4 days
| Buy | |
Trulab Peptides 10 mg | $45.00 $4.50/mg | Not on file | 2–5 days
| Buy | |
 Elite Edge Biotech 10 mg | $49.00 $4.90/mg | Not on file | 4–7 days
| Buy | |
 GenPeptide 5 mg | $50.00 $10.00/mg | Not on file | 2 days
| Buy | |
 Ignite Peptides 5 mg | $50.00 $10.00/mg | Not on file | 3-7 days
| Buy | |
$60.00 $12.00/mg | 1 COA | 1-2 days
| Buy |
United States, CanadaWhat is Sermorelin?
Sermorelin
Compound
Sermorelin
The reported molecular identity and sequence are consistent with PubChem and FDA substance records.
Why the 29-Residue Fragment Matters
Sermorelin represents the N-terminal 29 residues of GHRH in amidated form. Despite being shorter than native GHRH, early studies found that it could produce a substantial GH response in humans.
Its defined sequence also made Sermorelin useful for structure–activity research, where researchers modified individual amino acids and measured changes in biological activity.
What Human Studies Have Examined
Sermorelin research has looked at more than simply whether GH increases. Studies have examined dose response, timing, duration of GH release, and pituitary sensitivity.
Research in adults who had received cranial irradiation for childhood brain tumors found a markedly reduced GH response to GHRH(1–29)-NH₂, suggesting impaired pituitary responsiveness.
Sermorelin vs. CJC-1295
| Compound | Main structural feature | Length | Key distinction |
|---|---|---|---|
| Molecular basis | GHRH(1-29)-NH₂ | Modified GHRH analogue | |
| Design approach | Defined GHRH fragment | Engineered analogue | |
| Exposure | Short | Prolonged in DAC form | |
| Research interest | GHRH receptor response | Extended GHRH signaling |
The key distinction is structural: Sermorelin retains the defined GHRH(1–29) framework, while [CJC-1295](/peptides/cjc-1295) was engineered to modify its pharmacological behavior.
Factors That Influence the GH Response
The response to Sermorelin can vary with baseline GH activity, previous GHRH exposure, hypothalamic feedback, and other endocrine signals.
Studies have also examined how dopamine and cholinergic activity influence GHRH-stimulated GH release, highlighting the role of the broader hypothalamic-pituitary system.
## Why GH Measurement Matters
Older Sermorelin studies used different GH measurement methods, including immunoreactive GH and biological activity assays.
Because assay methods and sampling times can affect reported GH levels, results from different studies should be compared carefully.
## From Research Peptide to Geref
Sermorelin has a notable pharmaceutical history. Sermorelin acetate was marketed as Geref, with FDA marketing approval recorded on September 26, 1997, for a specific pediatric growth-related indication.
Geref was later withdrawn from the U.S. market, effective June 18, 2009. FDA records stated that the withdrawal was not for reasons of safety or effectiveness.
This history applies to the Geref pharmaceutical product and its approved indication, not automatically to current research-grade Sermorelin materials.
Regulatory and Research Context
Sermorelin has a documented history of human research and a former FDA-approved pharmaceutical product, but that does not automatically determine the regulatory status of current research materials.
When comparing a listing, check the identity, supplied form, specifications, [COA](/coas), stated purity, analytical documentation, quantity, and supplier information.
Sermorelin and WADA
Sermorelin is listed in the 2026 WADA Prohibited List under S2.2.4, within the growth hormone-releasing factors category.
The same section includes compounds such as CJC-1295 and tesamorelin, and S2 substances are prohibited at all times.
Research reference note
Research Use Disclaimer
[Peptide Grading](#vendor-listings) allows researchers to compare Sermorelin listings, including supplier details, specifications, quantities, COA availability, shipping information, and price per mg. The information is provided for research and informational purposes only; product documentation and regulatory status should be independently verified.
FAQ
Frequently asked questions.
GH is released in pulses, so sampling time, baseline levels, individual physiology, and study conditions can affect results.